Synaptophysin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88112

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Synaptophysin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%).

Marker

Pre-synaptic marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synaptophysin Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining in human cerebral cortex and liver tissues. Corresponding SYP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining of human duodenum shows moderate cytoplasmic positivity in enteroendocrine cells.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112]

Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Synaptophysin Antibody - BSA Free Western Blot: Synaptophysin Antibody - BSA Free [NBP1-88112]

Western Blot: Synaptophysin Antibody - BSA Free [NBP1-88112]

Analysis in human cerebral cortex tissue.

Applications for Synaptophysin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptophysin

Synaptophysin (Syp I), also called the major synaptic vesicle protein p38, is an integral membrane glycoprotein found in the synaptic vesicles of brain, neuron and neuroendocrine cells. Synaptophysin is one of the most abundant membrane proteins, comprising approximately 7% of the total protein in small synaptic vesicles. In mature nerve terminals it forms a complex with the vesicular membrane protein synaptobrevin, which appears to modulate synaptobrevin's interaction with the plasma membrane-associated proteins syntaxin and SNAP25 to form the SNARE complex as a prerequisite for membrane fusion. Synaptophysin may also be used as a neuroendocrine tumor marker in both neuroscience and cancer research.

Alternate Names

SYP

Gene Symbol

SYP

Additional Synaptophysin Products

Product Documents for Synaptophysin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptophysin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptophysin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptophysin Antibody - BSA Free and earn rewards!

Have you used Synaptophysin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies