Synaptotagmin 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69104

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Synaptotagmin 5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SYT5 (synaptotagmin V) The peptide sequence was selected form the middle region of SYT5. Peptide sequence: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Synaptotagmin 5 Antibody - BSA Free

Western Blot: Synaptotagmin 5 Antibody [NBP1-69104]

Western Blot: Synaptotagmin 5 Antibody [NBP1-69104]

Western Blot: Synaptotagmin 5 Antibody [NBP1-69104] - Human Fetal Kidney Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP1-69104]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP1-69104]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP1-69104] - Complete Mouse Retina Sections, antibody concentration 5 ug/ml.

Applications for Synaptotagmin 5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptotagmin 5

Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium. Synaptotagmins may act both as negative regulators of vesicle fusion, allowing fusion in the presence of calcium, and as calcium receptors or sensor molecules (summary by Hudson and Birnbaum, 1995 [PubMed 7597049]).

Alternate Names

synaptotagmin Vsynaptotagmin 5, synaptotagmin-5, SytV

Gene Symbol

SYT5

OMIM

NP_003171 (Human)

Additional Synaptotagmin 5 Products

Product Documents for Synaptotagmin 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptotagmin 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptotagmin 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptotagmin 5 Antibody - BSA Free and earn rewards!

Have you used Synaptotagmin 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies