Synaptotagmin 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62725

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Synaptotagmin 5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS

Reactivity Notes

Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synaptotagmin 5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Analysis in human cerebral cortex and skeletal muscle tissues using Anti-SYT5 antibody. Corresponding SYT5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725]

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Staining of human skeletal muscle shows low expression as expected.

Applications for Synaptotagmin 5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptotagmin 5

May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.

Alternate Names

synaptotagmin Vsynaptotagmin 5, synaptotagmin-5, SytV

Gene Symbol

SYT5

Additional Synaptotagmin 5 Products

Product Documents for Synaptotagmin 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptotagmin 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptotagmin 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptotagmin 5 Antibody - BSA Free and earn rewards!

Have you used Synaptotagmin 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies