Syntenin 1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00006386-B01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
View all Syntenin 1 Primary Antibodies »

Product Specifications

Immunogen

SDCBP (NP_001007068.1, 1 a.a. - 298 a.a.) full-length human protein. MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Specificity

SDCBP - syndecan binding protein (syntenin),

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for Syntenin 1 Antibody - Azide and BSA Free

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: Syntenin 1 Antibody [H00006386-B01P]

Immunocytochemistry/ Immunofluorescence: Syntenin 1 Antibody [H00006386-B01P]

Immunocytochemistry/Immunofluorescence: Syntenin 1 Antibody [H00006386-B01P] - Analysis of purified antibody to SDCBP on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - analysis of SDCBP expression in transfected 293T cell line by SDCBP purified MaxPab polyclonal antibody (B01P). Lane 1: SDCBP transfected lysate (32.40 KDa). Lane 2: Non-transfected lysate.
Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in human kidney.
Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in A-549.
Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P]

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody. Lane 1: SDCBP transfected lysate(32.78 KDa). Lane 2: Non-transfected lysate.

Applications for Syntenin 1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Syntenin 1

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

MDA9, MDA-9, melanoma differentiation associated protein-9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, ST1, SYCLTACIP18, syndecan binding protein (syntenin), Syndecan-binding protein 1, syntenin-1

Entrez Gene IDs

6386 (Human)

Gene Symbol

SDCBP

UniProt

NP_001007068.1 (Human)

Additional Syntenin 1 Products

Product Documents for Syntenin 1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntenin 1 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Syntenin 1 Antibody - Azide and BSA Free

Customer Reviews for Syntenin 1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Syntenin 1 Antibody - Azide and BSA Free and earn rewards!

Have you used Syntenin 1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies