TAF11 Antibody (3E7) - Azide and BSA Free

Novus Biologicals | Catalog # H00006882-M07

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3E7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF

Localization

Nuclear

Specificity

TAF11 - TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for TAF11 Antibody (3E7) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TAF11 Antibody (3E7) [H00006882-M07]

Immunocytochemistry/ Immunofluorescence: TAF11 Antibody (3E7) [H00006882-M07]

Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3E7) [H00006882-M07] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: TAF11 Antibody (3E7) [H00006882-M07] - Detection limit for recombinant GST tagged TAF11 is approximately 0.03ng/ml as a capture antibody.

Applications for TAF11 Antibody (3E7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TAF11

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure.

Alternate Names

28kDa, TAF(II)28, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2IMGC:15243, TAFII-28, TAFII28TFIID subunit p30-beta, TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD, transcription initiation factor TFIID 28 kD subunit, Transcription initiation factor TFIID 28 kDa subunit, transcription initiation factor TFIID subunit 11

Entrez Gene IDs

6882 (Human)

Gene Symbol

TAF11

OMIM

600772 (Human)

Additional TAF11 Products

Product Documents for TAF11 Antibody (3E7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF11 Antibody (3E7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF11 Antibody (3E7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TAF11 Antibody (3E7) - Azide and BSA Free and earn rewards!

Have you used TAF11 Antibody (3E7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...