TAF6L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39083

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF6L Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TAF6L Antibody [NBP2-39083]

Immunocytochemistry/ Immunofluorescence: TAF6L Antibody [NBP2-39083]

Immunocytochemistry/Immunofluorescence: TAF6L Antibody [NBP2-39083] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TAF6L Antibody [NBP2-39083]

Immunohistochemistry-Paraffin: TAF6L Antibody [NBP2-39083]

Immunohistochemistry-Paraffin: TAF6L Antibody [NBP2-39083] - Staining of human testis shows moderate nuclear positivity in in subset of cells in seminiferous ducts.
TAF6L Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TAF6L Antibody - BSA Free [NBP2-39083]

Chromatin Immunoprecipitation-exo-Seq: TAF6L Antibody - BSA Free [NBP2-39083]

ChIP-Exo-Seq composite graph for Anti-TAF6L (NBP2-39083) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TAF6L Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF6L

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF6. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.

Alternate Names

FLJ11136, p300/CBP-associated factor (PCAF)-associated factor 65, PAF65-alpha, PAF65AMGC4288, PCAF-associated factor 65 alpha, PCAF-associated factor 65-alpha, TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa

Gene Symbol

TAF6L

UniProt

Additional TAF6L Products

Product Documents for TAF6L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF6L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF6L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF6L Antibody - BSA Free and earn rewards!

Have you used TAF6L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...