TAK1 Recombinant Protein Antigen

Name: TAK1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-87819PEP
Price: 279 USD
Availability: InStock

Novus Biologicals | Catalog # NBP1-87819PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition

View all TAK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP3K7.

Source: E. coli

Amino Acid Sequence: NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87819.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-87819PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: TAK1

TAK1 (or MAP3K7) was shown to participate in regulation of transcription by transforming growth factor beta (TGF beta). TAK1 is stimulated in response to TGF beta and bone morphogenetic protein. These results suggest that TAK1 functions as a mediator in the signaling pathway of TGF beta superfamily members. TAB1 and TAB2 are TAK1 binding proteins that may function as activators of the TAK1 (TGF b activated kinase 1) MAPKKK in TGF b signal transduction. TAB1 induced TAK1 activation promoted the dissociation of active forms of IKKa and IKK b from active TAK1, whereas the IKK mutants remained to interact with active TAK1. TNF a activated endogenous TAK1, and the kinase negative TAK1 acted as a dominant negative inhibitor against TNF a induced NFkB activation. TAK1 was suggested to act as a regulatory kinase of IKKs.

Long Name

TGF-beta activated kinase 1

Alternate Names

MAP3K7, TGF1a

Gene Symbol

MAP3K7

Additional TAK1 Products

Product Documents for TAK1 Recombinant Protein Antigen

Download Product Datasheets

Download Antigen Blocking Protocol

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TAK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.