Tapasin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59071

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TAPBP(TAP binding protein (tapasin)) The peptide sequence was selected from the C terminal of TAPBP. Peptide sequence GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tapasin Antibody - BSA Free

Western Blot: Tapasin Antibody [NBP1-59071]

Western Blot: Tapasin Antibody [NBP1-59071]

Western Blot: Tapasin Antibody [NBP1-59071] - Antibody Titration: 1 ug/ml Human liver.

Immunohistochemistry: Tapasin Antibody [NBP1-59071] -

Immunohistochemistry: Tapasin Antibody [NBP1-59071] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071]

Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071]

Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.
Western Blot: Tapasin Antibody [NBP1-59071]

Western Blot: Tapasin Antibody [NBP1-59071]

Western Blot: Tapasin Antibody [NBP1-59071] - analysis of HepG2 tissue lysate at a concentration of 0.5ug/ml.

Applications for Tapasin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tapasin

TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.

Alternate Names

NGS17, TAP Binding Protein, TAPA, TAPBP, TPN, TPSN

Gene Symbol

TAPBP

UniProt

Additional Tapasin Products

Product Documents for Tapasin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tapasin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Tapasin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tapasin Antibody - BSA Free and earn rewards!

Have you used Tapasin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...