TBC1D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54654

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TBC1D1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TBC1D1(TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1) The peptide sequence was selected from the middle region of TBC1D1. Peptide sequence RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

133 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TBC1D1 Antibody - BSA Free

Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654]

Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654]

Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654] - Human Kidney tissue, 5 ug/ml.
Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654]

Western Blot: TBC1D1 Antibody [NBP1-54654] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml

Applications for TBC1D1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBC1D1

TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (White et al., 2000 [PubMed 10965142]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-225 BC050321.1 13-237 226-950 BC050321.1 896-1620 951-1020 BC028196.1 226-295 1021-1123 BC029950.1 255-357 1124-1433 BC028196.1 399-708 1434-1608 BC029950.1 668-842 1609-4133 BC053648.1 437-2961 4134-5688 AK074954.1 1433-2987

Alternate Names

KIAA1108TBC, TBC1, TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1, TBC1 domain family member 1

Gene Symbol

TBC1D1

UniProt

Q86TI0 (Human)

Additional TBC1D1 Products

Product Documents for TBC1D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TBC1D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBC1D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBC1D1 Antibody - BSA Free and earn rewards!

Have you used TBC1D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies