TBRG4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58726

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TBRG4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TBRG4 Antibody - BSA Free

Western Blot: TBRG4 Antibody [NBP2-58726]

Western Blot: TBRG4 Antibody [NBP2-58726]

Western Blot: TBRG4 Antibody [NBP2-58726] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TBRG4 Antibody [NBP2-58726]

Immunocytochemistry/ Immunofluorescence: TBRG4 Antibody [NBP2-58726]

Immunocytochemistry/Immunofluorescence: TBRG4 Antibody [NBP2-58726] - Staining of human cell line A-431 shows localization to mitochondria.

Applications for TBRG4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBRG4

TBRG4 (transforming growth factor beta regulator 4) was originally identified as a cell cycle progression restoration (CPR) gene that, when over expressed, was capable of promoting G1 progression in the presence of yeast pheromone arresting signals.

Alternate Names

cell cycle progression 2 protein, Cell cycle progression protein 2, Cell cycle progression restoration protein 2, CPR2, FAST kinase domains 4, FASTKD4Cpr2, KIAA0948H_TD2522F11.8, protein TBRG4, transforming growth factor beta regulator 4FAST kinase domain-containing protein 4

Gene Symbol

TBRG4

Additional TBRG4 Products

Product Documents for TBRG4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TBRG4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBRG4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBRG4 Antibody - BSA Free and earn rewards!

Have you used TBRG4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies