TCEAL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10374

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCEAL1 (NP_001006641). Peptide sequence EGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TCEAL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TCEAL1 Antibody [NBP3-10374]

Immunohistochemistry-Paraffin: TCEAL1 Antibody [NBP3-10374]

Immunohistochemistry-Paraffin: TCEAL1 Antibody [NBP3-10374] - Immunohistochemical analysis of paraffin-embedded human heart cell tissue.

Applications for TCEAL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCEAL1

TCEAL1 encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.

Alternate Names

Nuclear phosphoprotein p21/SIIR, P21, pp21, SIIRTCEA-like protein 1, transcription elongation factor A (SII)-like 1, transcription elongation factor A protein-like 1, Transcription elongation factor S-II protein-like 1

Gene Symbol

TCEAL1

Additional TCEAL1 Products

Product Documents for TCEAL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TCEAL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCEAL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCEAL1 Antibody - BSA Free and earn rewards!

Have you used TCEAL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...