TCP1-eta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58218

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TCP1-eta Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CCT7(chaperonin containing TCP1, subunit 7 (eta)) The peptide sequence was selected from the middle region of CCT7. Peptide sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: eta.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TCP1-eta Antibody - BSA Free

Western Blot: TCP1-eta Antibody [NBP1-58218]

Western Blot: TCP1-eta Antibody [NBP1-58218]

Western Blot: TCP1-eta Antibody [NBP1-58218] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young University
Immunohistochemistry: TCP1-eta Antibody [NBP1-58218]

Immunohistochemistry: TCP1-eta Antibody [NBP1-58218]

Immunohistochemistry: TCP1-eta Antibody [NBP1-58218] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: TCP1-eta Antibody [NBP1-58218]

Western Blot: TCP1-eta Antibody [NBP1-58218]

Western Blot: TCP1-eta Antibody [NBP1-58218] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for TCP1-eta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCP1-eta

CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.

Alternate Names

CCTETA, CCT-eta, Ccth, chaperonin containing TCP1, subunit 7 (eta), eta subunit, HIV-1 Nef interacting protein, HIV-1 Nef-interacting protein, MGC110985, Nip7-1, T-complex protein 1 subunit eta

Gene Symbol

CCT7

UniProt

Q99832 (Human)

Additional TCP1-eta Products

Product Documents for TCP1-eta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TCP1-eta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCP1-eta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCP1-eta Antibody - BSA Free and earn rewards!

Have you used TCP1-eta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies