TEAD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33803

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TEAD4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TEAD4 Antibody [NBP2-33803]

Immunocytochemistry/ Immunofluorescence: TEAD4 Antibody [NBP2-33803]

Immunocytochemistry/Immunofluorescence: TEAD4 Antibody [NBP2-33803] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803]

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
TEAD4 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TEAD4 Antibody - BSA Free [NBP2-33803]

Chromatin Immunoprecipitation-exo-Seq: TEAD4 Antibody - BSA Free [NBP2-33803]

ChIP-Exo-Seq composite graph for Anti-TEAD4 (NBP2-33803) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TEAD4 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TEAD4

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Alternate Names

EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3

Gene Symbol

TEAD4

UniProt

Additional TEAD4 Products

Product Documents for TEAD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TEAD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TEAD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TEAD4 Antibody - BSA Free and earn rewards!

Have you used TEAD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...