TET1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88972
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TET1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TET1 Antibody [NBP1-88972]
Immunocytochemistry/Immunofluorescence: TET1 Antibody [NBP1-88972] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human cerebellum shows moderate nuclear positivity in purkinje cells.Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.Applications for TET1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TET1
Recent studies have shown a role for TET1 in mediating epigenetic changes, such as DNA methylation status, in response to environmental factors such as food and nutrition, exercise, radiation, and allergens (3). The balance between DNA methylation and demethylation is crucial in health and homeostasis (3,5). In addition to response to environmental exposures, TET1 also plays a role in different diseases and cancer subtypes where it can function as either a tumor suppressor or tumor promoter (2,5). TET1 was originally identified as a fusion partner for the mixed lineage leukemia (MLL) gene in acute myeloid leukemia (AML) (1-3). While TET1 expression is low in AML, it is highly expressed in T-cell acute lymphoblastic leukemia (T-ALL) (2). Similarly, TET1 expression is suppressed in hormone receptor positive breast cancer (HRBC) but elevated in triple negative breast cancer (2). TET1 is a potential therapeutic target in certain cancers, but due to its complex role in different signaling pathways its potential needs to be more widely studied (2). While TET1 is primarily responsible for initiating DNA demethylation, it also functions alongside 5hmc in maintaining pluripotency in embryonic stem cells (ESCs) and can serve as a marker for differentiation (1,2,4,5).
References
1. Tan L, Shi YG. Tet family proteins and 5-hydroxymethylcytosine in development and disease. Development. 2012;139(11):1895-1902. https://doi.org/10.1242/dev.070771
2. Liu W, Wu G, Xiong F, Chen Y. Advances in the DNA methylation hydroxylase TET1. Biomark Res. 2021;9(1):76. https://doi.org/10.1186/s40364-021-00331-7
3. Zhu T, Brown AP, Ji H. The Emerging Role of Ten-Eleven Translocation 1 in Epigenetic Responses to Environmental Exposures. Epigenet Insights. 2020;13:2516865720910155. https://doi.org/10.1177/2516865720910155
4. Melamed P, Yosefzon Y, David C, Tsukerman A, Pnueli L. Tet Enzymes, Variants, and Differential Effects on Function. Front Cell Dev Biol. 2018;6:22. https://doi.org/10.3389/fcell.2018.00022
5. Ma C, Seong H, Liu Y, Yu X, Xu S, Li Y. Ten-eleven translocation proteins (TETs): tumor suppressors or tumor enhancers?. Front Biosci (Landmark Ed). 2021;26(10):895-915. https://doi.org/10.52586/4996
6. Uniprot (Q8NFU7)
Long Name
Methylcytosine dioxygenase TET1
Alternate Names
CXXC6, EC 1.14.11.n2, KIAA1676, LCX
Entrez Gene IDs
80312 (Human)
Gene Symbol
TET1
UniProt
Additional TET1 Products
Product Documents for TET1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TET1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TET1 Antibody - BSA Free
Customer Reviews for TET1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TET1 Antibody - BSA Free and earn rewards!
Have you used TET1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...