TET1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88972

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TET1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TET1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TET1 Antibody [NBP1-88972]

Immunocytochemistry/ Immunofluorescence: TET1 Antibody [NBP1-88972]

Immunocytochemistry/Immunofluorescence: TET1 Antibody [NBP1-88972] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human cerebellum shows moderate nuclear positivity in purkinje cells.
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972]

Immunohistochemistry-Paraffin: TET1 Antibody [NBP1-88972] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Applications for TET1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

Reported in scientific literature (PMID: 26622665)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TET1

TET1 (Ten-eleven translocation 1), also called methylcytosine dioxygenase TET1 or CXXC6, is one of three members of the human TET protein family of alpha-ketoglutarate oxygenases which includes TET2 and TET3 (1-3). TET1 is an enzyme that plays a role in epigenetic regulation of DNA methylation by conversion of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC), and further to 5-formylcystosine (5fC) and 5-carboxylcystosine (5caC) (1-5). The human TET1 protein is 2136 amino acids in length with a theoretical molecular weight of 235 kDa (6). Primary features of the TET1 protein include an N-terminal CXXC domain responsible for binding CpG islands in DNA, and a C-terminal catalytic domain containing a Cys-rich region followed by a double-stranded beta-helix (DSBH) domain that contributes to the mC dioxygenase activity and metal binding (1,2,4,5).

Recent studies have shown a role for TET1 in mediating epigenetic changes, such as DNA methylation status, in response to environmental factors such as food and nutrition, exercise, radiation, and allergens (3). The balance between DNA methylation and demethylation is crucial in health and homeostasis (3,5). In addition to response to environmental exposures, TET1 also plays a role in different diseases and cancer subtypes where it can function as either a tumor suppressor or tumor promoter (2,5). TET1 was originally identified as a fusion partner for the mixed lineage leukemia (MLL) gene in acute myeloid leukemia (AML) (1-3). While TET1 expression is low in AML, it is highly expressed in T-cell acute lymphoblastic leukemia (T-ALL) (2). Similarly, TET1 expression is suppressed in hormone receptor positive breast cancer (HRBC) but elevated in triple negative breast cancer (2). TET1 is a potential therapeutic target in certain cancers, but due to its complex role in different signaling pathways its potential needs to be more widely studied (2). While TET1 is primarily responsible for initiating DNA demethylation, it also functions alongside 5hmc in maintaining pluripotency in embryonic stem cells (ESCs) and can serve as a marker for differentiation (1,2,4,5).

References

1. Tan L, Shi YG. Tet family proteins and 5-hydroxymethylcytosine in development and disease. Development. 2012;139(11):1895-1902. https://doi.org/10.1242/dev.070771

2. Liu W, Wu G, Xiong F, Chen Y. Advances in the DNA methylation hydroxylase TET1. Biomark Res. 2021;9(1):76. https://doi.org/10.1186/s40364-021-00331-7

3. Zhu T, Brown AP, Ji H. The Emerging Role of Ten-Eleven Translocation 1 in Epigenetic Responses to Environmental Exposures. Epigenet Insights. 2020;13:2516865720910155. https://doi.org/10.1177/2516865720910155

4. Melamed P, Yosefzon Y, David C, Tsukerman A, Pnueli L. Tet Enzymes, Variants, and Differential Effects on Function. Front Cell Dev Biol. 2018;6:22. https://doi.org/10.3389/fcell.2018.00022

5. Ma C, Seong H, Liu Y, Yu X, Xu S, Li Y. Ten-eleven translocation proteins (TETs): tumor suppressors or tumor enhancers?. Front Biosci (Landmark Ed). 2021;26(10):895-915. https://doi.org/10.52586/4996

6. Uniprot (Q8NFU7)

Long Name

Methylcytosine dioxygenase TET1

Alternate Names

CXXC6, EC 1.14.11.n2, KIAA1676, LCX

Entrez Gene IDs

80312 (Human)

Gene Symbol

TET1

UniProt

Q8NFU7 (Human)

Additional TET1 Products

Product Documents for TET1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TET1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TET1 Antibody - BSA Free

Customer Reviews for TET1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TET1 Antibody - BSA Free and earn rewards!

Have you used TET1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies