TET2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35520

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TET2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 (NP_001120680.1).

Sequence:
VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

224 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TET2 Antibody - BSA Free

TET2 Antibody

Immunohistochemistry: TET2 Antibody [NBP3-35520] -

Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TET2 Antibody

Western Blot: TET2 Antibody [NBP3-35520] -

Western Blot: TET2 Antibody [NBP3-35520] - Western blot analysis of lysates from Mouse heart, using TET2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
TET2 Antibody

Immunohistochemistry: TET2 Antibody [NBP3-35520] -

Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Human colon using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for TET2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TET2

Long Name

Methylcytosine dioxygenase TET2

Alternate Names

KIAA1546, Nbla00191

Gene Symbol

TET2

Additional TET2 Products

Product Documents for TET2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TET2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TET2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TET2 Antibody - BSA Free and earn rewards!

Have you used TET2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies