TFAP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35696

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TFAP4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1).

Sequence:
QQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TFAP4 Antibody - BSA Free

TFAP4 Antibody

Immunocytochemistry/ Immunofluorescence: TFAP4 Antibody [NBP3-35696] -

Immunocytochemistry/ Immunofluorescence: TFAP4 Antibody [NBP3-35696] - Immunofluorescence analysis of C6 cells using [KO Validated] TFAP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TFAP4 Antibody

Western Blot: TFAP4 Antibody [NBP3-35696] -

Western Blot: TFAP4 Antibody [NBP3-35696] - Western blot analysis of various lysates using [KO Validated] TFAP4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.
TFAP4 Antibody

Immunocytochemistry/ Immunofluorescence: TFAP4 Antibody [NBP3-35696] -

Immunocytochemistry/ Immunofluorescence: TFAP4 Antibody [NBP3-35696] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] TFAP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TFAP4 Antibody

Western Blot: TFAP4 Antibody [NBP3-35696] -

Western Blot: TFAP4 Antibody [NBP3-35696] - Western Blot analysis of lysates from wild type (WT) and TFAP4 knockout (KO) HeLa cells, using [KO Validated] TFAP4 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60S.

Applications for TFAP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TFAP4

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 (PubMed 2833704); Hu et al., 1990 (PubMed 2123466)).(supplied by OMIM)

Alternate Names

Activating enhancer-binding protein 4, AP-4, BHLHC41, bHLHc41Class C basic helix-loop-helix protein 41, transcription factor AP-4, transcription factor AP-4 (activating enhancer binding protein 4), transcription factor AP-4 (activating enhancer-binding protein 4)

Gene Symbol

TFAP4

Additional TFAP4 Products

Product Documents for TFAP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TFAP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFAP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFAP4 Antibody - BSA Free and earn rewards!

Have you used TFAP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies