TFF1/pS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90813

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TFF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TFF1/pS2 Antibody - BSA Free

Western Blot: TFF1/pS2 Antibody [NBP1-90813]

Western Blot: TFF1/pS2 Antibody [NBP1-90813]

Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in ysate from HEK293 cells. Image from a verified customer review.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813]

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813]

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813]

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813]

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows high expression.

Applications for TFF1/pS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-90813 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFF1

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Long Name

Trefoil Factor 1

Alternate Names

BCEI, D21S21, HPS2, PNR-2, PS2

Gene Symbol

TFF1

Additional TFF1 Products

Product Documents for TFF1/pS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TFF1/pS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Citations for TFF1/pS2 Antibody - BSA Free

Customer Reviews for TFF1/pS2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used TFF1/pS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Shilpa Agarwal
    Application: Western Blot
    Sample Tested: Lysate from HEK293 cells
    Species: Human
    Verified Customer | Posted 12/09/2014
    Immunoblot for TFF1
    TFF1/pS2 Antibody - BSA Free NBP1-90813

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies