Thioredoxins (Trxs) are a group of small ubiquitous proteins that are key regulators of cellular redox balance. The mammalian Trx family includes the secreted and cellular protein (Trx-1), the mitochondria-specific Trx-2, the Trx-like cytosolic protein p32TrxL, a truncated version of Trx-1 known as Trx80, and the thioredoxin-related protein, TRP-14. Trx-1 is secreted by lymphocytes, hepatocytes, fibroblasts, and several tumor cells. Trx-1 acts as a growth factor an, antioxidant, a cofactor that provides reducing equivalents, and a transcriptional regulator. Expression of Trx-1 is increased under various stress conditions such as hypoxia and viral and bacterial infections. It also serves as a biomarker for rheumatoid arthritis.
Thioredoxin-1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-48873
![Western Blot: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Western-Blot-NBP2-48873-img0003.jpg "Western Blot: Thioredoxin-1 Antibody [NBP2-48873]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA
Reactivity Notes
Mouse (88%), Rat (88%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Thioredoxin-1 Antibody - BSA Free (NBP2-48873) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Thioredoxin-1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Thioredoxin-1 Antibody - BSA Free
Western Blot: Thioredoxin-1 Antibody [NBP2-48873]
Western Blot: Thioredoxin Antibody [NBP2-48873] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
![Immunocytochemistry/ Immunofluorescence: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48873-img0009.jpg "Immunocytochemistry/ Immunofluorescence: Thioredoxin-1 Antibody [NBP2-48873]")
Immunocytochemistry/ Immunofluorescence: Thioredoxin-1 Antibody [NBP2-48873]
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-48873] - Staining of human cell line U-251 MG shows localization to nucleus and cytosol. Antibody staining is shown in greeen.![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0012.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]
Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human kidney.![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0006.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]
Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human esophagus shows high expression.![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0007.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]
Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human skeletal muscle shows low expression as expected.![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0008.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0010.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]
Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human colon, esophagus, kidney and skeletal muscle using Anti-TXN antibody NBP2-48873 (A) shows similar protein distribution across tissues to independent antibody NBP2-49191 (B).![Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]](https://beta-resources.rndsystems.com/images/products/Thioredoxin-Antibody-Immunohistochemistry-Paraffin-NBP2-48873-img0011.jpg "Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]")
Immunohistochemistry-Paraffin: Thioredoxin-1 Antibody [NBP2-48873]
Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human colon.Applications for Thioredoxin-1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Thioredoxin-1
Alternate Names
Thioredoxin1, Trx1, TXN, TXN1
Gene Symbol
TXN
Additional Thioredoxin-1 Products
Product Documents for Thioredoxin-1 Antibody - BSA Free
Product Specific Notices for Thioredoxin-1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Thioredoxin-1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Thioredoxin-1 Antibody - BSA Free and earn rewards!
Have you used Thioredoxin-1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
