Thioredoxin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54673

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Thioredoxin-2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TXN2(thioredoxin 2) The peptide sequence was selected from the middle region of TXN2 (NP_036605). Peptide sequence VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Thioredoxin-2 Antibody - BSA Free

Western Blot: Thioredoxin-2 Antibody [NBP1-54673]

Western Blot: Thioredoxin-2 Antibody [NBP1-54673]

Western Blot: Thioredoxin-2 Antibody [NBP1-54673] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Thioredoxin-2 Antibody [NBP1-54673]

Immunohistochemistry: Thioredoxin-2 Antibody [NBP1-54673]

Immunohistochemistry: Thioredoxin-2 Antibody [NBP1-54673] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for Thioredoxin-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thioredoxin-2

TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

MT-TRX, Thioredoxin2, Trx2, TXN2

Entrez Gene IDs

25828 (Human)

Gene Symbol

TXN2

UniProt

Q99757 (Human)

Additional Thioredoxin-2 Products

Product Documents for Thioredoxin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Thioredoxin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thioredoxin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thioredoxin-2 Antibody - BSA Free and earn rewards!

Have you used Thioredoxin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

MAPK Signaling: Oxidative Stress Pathway MAPK Signaling: Oxidative Stress Pathway Thumbnail