TIAL1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-79932
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Zebrafish
Cited:
Fish - Danio rerio (Zebrafish)
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence, In-situ Hybridization
Cited:
Immunocytochemistry/ Immunofluorescence, In Situ Hybridization
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Zebrafish reactivity reported in scientific literature (PMIDs: 27489304 and 29975683).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for TIAL1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932]
TIAL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79932-img0005.jpgWestern Blot: TIAL1 Antibody [NBP1-79932]
Western Blot: TIAL1 Antibody [NBP1-79932] - Host: Rabbit. Target: TIAL1. Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Liver (M-LI). Antibody concentration: 2ug/mlWestern Blot: TIAL1 Antibody [NBP1-79932]
Western Blot: TIAL1 Antibody [NBP1-79932] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] -
Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] - rbpms2 mutant allele stability & localization activity in somatic cells.(A) RT-PCR to detect rbpms2a & rbpms2b maternal transcripts. Pink asterisks indicate likely nonsense mediated decay of mutant allele transcripts. (B-F) Wild-type GFP-Rbpms2a/b (B, D) & GFP-Rbpms2bsa9329 (F) localize to granules in HEK 293 cells, while GFP-Rbpms2aae30 & GFP-Rbpms2bae32 are not localized. (G-K) Zebrafish blastula cells expressing GFP-Rbpms2 fusions. (G,H) Wild-type GFP-Rbpms2b localizes near the nucleus (H), is apparently associated with the centrosome/spindle in some cells, & (G) is in granules that are not positive for the stress granule marker Tial-1. (H) A subset of GFP-Rbpms2b positive granules are positive for the p-body marker Dcp2 (open arrowheads). (I) GFP-Rbpms2bsa9329 localization to the centrosome/spindle but not granules. (J) GFP-Rbpms2bae32 & (K) GFP-Rbpms2aae30 localization. Insets show magnified views of the highlighted cells. Images are representative slices from Z-stacks of sphere stage embryos viewed from the animal pole. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29975683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TIAL1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 29975683). Use in In-situ Hybridization reported in scientific literature (PMID: 27489304).
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TIAL1
Alternate Names
aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR
Gene Symbol
TIAL1
UniProt
Additional TIAL1 Products
Product Documents for TIAL1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TIAL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TIAL1 Antibody - BSA Free
Customer Reviews for TIAL1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TIAL1 Antibody - BSA Free and earn rewards!
Have you used TIAL1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...