TMEM119 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30551

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Rat, Porcine, Feline

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Feline, Porcine reactivity reported from verified customer reviews.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMEM119 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining in human lymph node and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody NBP2-30551 (A) shows similar protein distribution across tissues to independent antibody NBP2-30792 (B).
Immunocytochemistry/ Immunofluorescence: TMEM119 Antibody [NBP2-30551]

Immunocytochemistry/ Immunofluorescence: TMEM119 Antibody [NBP2-30551]

Immunocytochemistry/Immunofluorescence: TMEM119 Antibody [NBP2-30551] - Human microglia cell line stained with TMEM antibody and DAPI. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex shows weak positivity in microglia.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551]

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human testis shows weak membranous positivity in cells in lamina propria.

Applications for TMEM119 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Verified from a customer review.

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Frozen

Verified from a customer review.

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 5 reviews rated 2.6 using NBP2-30551 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM119

ATF4 is an approximately 38 kDa member of the bzip family of transcription factors. It plays an important role autophagy, the unfolded protein response, and the response to oxygen and nutrient deprivation. These functions are regulated by the dimerization of ATF4 with the leucine zipper protein FIAT. ATF4 contains a basic DNA-binding domain (aa 280-300) and a leucine zipper domain (aa 306-334).

Long Name

Transmembrane Protein 119

Alternate Names

OBIF

Gene Symbol

TMEM119

UniProt

Additional TMEM119 Products

Product Documents for TMEM119 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEM119 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for TMEM119 Antibody - BSA Free

Customer Reviews for TMEM119 Antibody - BSA Free (5)

2.6 out of 5
5 Customer Ratings
5 Stars
0%
4 Stars
40%
3 Stars
20%
2 Stars
0%
1 Stars
40%

Have you used TMEM119 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 5 of 5 reviews Showing All
Filter By:
  • TMEM119 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Human microglia
    Species: Human
    Verified Customer | Posted 05/20/2021
    Tmem staining with dapi in human microglai cell line
    TMEM119 Antibody - BSA Free NBP2-30551
  • TMEM119 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Coronal rat brain slices and Adult brain
    Species: Rat
    Verified Customer | Posted 07/28/2020
    Confocal images from the rat hippocampal CA1 area. Green: Tmem119 1:100 + a-rabbit A488 1:200. Red: NT640/660 1:250. Tmem119 labelled most cell bodies in the hippocampus, esp. neuronal somas. Thus, the antibody is not selective for microglial cells.
    Rats were perfused with 4% paraformaldehyde in PBS (pH=7.6). The brain was removed and immersed in PFA then in 30% sucrose. The brain was sliced with a freezing microtome. A mixture of 1% Triton-X and 10% donkey serum (in TRIS) was used for antigen retrieval and blocking. Tmem119 antibody was used in 1:100 dilution and was visualized by an Alexa-488 conjugated anti-rabbit secondary antibody (1:200). Cell bodies were stained with NeuroTrace 640/660 (1:250).
    TMEM119 Antibody - BSA Free NBP2-30551
    Bio-Techne Response
    Thank you for reviewing our product. We are sorry to hear that this product did not perform as expected. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction.
  • TMEM119 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Brain (hypothalamus) tissue
    Species: Sheep
    Verified Customer | Posted 03/13/2020
    Photomicrograph at 40x magnification of a sheep hypothalamic section stained using Rabbit polyclonal TMEM119 antibody NBP2-30551. Results showed no positive staining in our tissue using this antibody.
    To test, we used free-floating sheep hypothalamic brain sections from two animals. We did dilutions of 1:100 to 1:1000 and did not see any staining in our tissue using this antibody NBP2-30551. We also employed an antigen retrieval step in one of our runs, and it did not yield any positive staining.
    TMEM119 Antibody - BSA Free NBP2-30551
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • TMEM119 Antibody
    Name: Vicki Swier
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Brain (cerebral cortex), Brain (hippocampus) tissue, brain (thalamus) and brain (aqueduct)
    Species: Swine
    Verified Customer | Posted 04/23/2018
    Pig cerebral cortex
    1:100 dilution. 5 minute DAB stain. Polymer secondary. pH 6 Citrate buffer used for antigen retrieval by steam heat.
    TMEM119 Antibody - BSA Free NBP2-30551
  • TMEM119 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: optic nerve and Nerve pia mater
    Species: Feline
    Verified Customer | Posted 01/31/2017
    1:200 concentration. Green-TMEM119, Blue-DAPI
    PFA fixed and cryoprotected tissue.
    TMEM119 Antibody - BSA Free NBP2-30551

There are no reviews that match your criteria.

Showing  1 - 5 of 5 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...