TMEM18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35869

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TMEM18 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2).

Sequence:
LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TMEM18 Antibody - BSA Free

TMEM18 Antibody

Western Blot: TMEM18 Antibody [NBP3-35869] -

Western Blot: TMEM18 Antibody [NBP3-35869] - Western blot analysis of various lysates using TMEM18at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.

Applications for TMEM18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TMEM18

TMEM18 is an obesity risk gene. It is a small protein of 140 residues and is predicted to be mostly alpha-helical with three transmembrane parts. TMEM18 forms homooligomers, independently of the DNA-binding domain. TMEM18 localizes to the nuclear membrane and binds to DNA in a sequence-specific manner. TMEM18 is a transcription repressor sequence-specific ssDNA and dsDNA binding protein with preference for GCT end CTG repeats. TMEM18 is a cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).

Long Name

Transmembrane Protein 18

Alternate Names

transmembrane protein 18

Gene Symbol

TMEM18

Additional TMEM18 Products

Product Documents for TMEM18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TMEM18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMEM18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM18 Antibody - BSA Free and earn rewards!

Have you used TMEM18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies