Tmp21/p23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48969

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tmp21/p23 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Tmp21/p23 Antibody - BSA Free (NBP2-48969) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Tmp21/p23 Antibody - BSA Free

Western Blot: Tmp21/p23 Antibody [NBP2-48969]

Western Blot: Tmp21/p23 Antibody [NBP2-48969]

Western Blot: Tmp21/p23 Antibody [NBP2-48969] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human kidney.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human stomach shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining in human thyroid gland and skeletal muscle tissues using anti-TMED10 antibody. Corresponding TMED10 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human colon, kidney, pancreas and testis using Anti-TMED10 antibody NBP2-48969 (A) shows similar protein distribution across tissues to independent antibody NBP2-47600 (B).
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human testis.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human colon.
Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969]

Immunohistochemistry-Paraffin: Tmp21/p23 Antibody [NBP2-48969] - Staining of human pancreas.

Applications for Tmp21/p23 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tmp21/p23

TMP21 is a ubiquitously expressed protein that is involved in vesicular targeting and protein transport. More recent experiments have shown that it is also a component in the presenilin complex and modulates the gamma-secretase, but not the epsilon-secretase cleavage activity of the amyloid precursor protein. The presenilin complex is composed of the proteins APH1, nicastrin, and PEN2 in addition to presenilin-1. Together, these proteins cleave the amyloid precursor protein at what is known as the gamma- and epsilon-sites, and can lead to the accumulation of the Abeta cleavage product that is associated with Alzheimer's disease. Co-immunoprecipitation experiments using antibodies against these proteins also yielded TMP21, indicating that TMP21 may play a role in the regulation of this complex. Suppression of TMP21 expression by siRNA in transfected cells caused increased gamma-secretase activity and Abeta production, but not epsilon-secretase activity, demonstrating that TMP21 can modulate gamma-secretase activity.

Long Name

21 kDa Transmembrane Trafficking Protein

Alternate Names

p24delta, S31I125, S31III125, TMED10

Gene Symbol

TMED10

Additional Tmp21/p23 Products

Product Documents for Tmp21/p23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tmp21/p23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Aspartic Proteases and Regulators

Customer Reviews for Tmp21/p23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tmp21/p23 Antibody - BSA Free and earn rewards!

Have you used Tmp21/p23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies