TORC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89865

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TORC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV

Reactivity Notes

Rat (86%), Mouse (84%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TORC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TORC1 Antibody [NBP1-89865]

Immunocytochemistry/ Immunofluorescence: TORC1 Antibody [NBP1-89865]

Immunocytochemistry/Immunofluorescence: TORC1 Antibody [NBP1-89865] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865]

Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.
TORC1 Antibody - BSA Free Western Blot: TORC1 Antibody - BSA Free [NBP1-89865]

Western Blot: TORC1 Antibody - BSA Free [NBP1-89865]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
TORC1 Antibody - BSA Free Western Blot: TORC1 Antibody - BSA Free [NBP1-89865]

Western Blot: TORC1 Antibody - BSA Free [NBP1-89865]

Analysis in human cell line BEWO.

Applications for TORC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TORC1

MECT1 (also known as MucoEpidermoid Carcinoma Translocated 1, Transducer of regulated cAMP response element-binding protein 1, TORC1, and Transducer of CREB protein 1) is a nuclear protein that functions as a transcriptional coactivator for CREB1, which activates transcription through both consensus and variant cAMP response element (CRE) sites. MECT1does not appear to modulate CREB1 DNA-binding activity but enhances the interaction of CREB1 with TAF4/TAFII-130. MECT1 translocates with MAML2 (MasterMind-Like Protein 2) to yield a fusion oncogene: t(11;19) (q21;p13). This translocation occurs in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. The novel fusion product that results disrupts the Notch signaling pathway. The fusion protein consists of the N-terminus of MECT1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of MECT1 has been detected in a small number of mucoepidermoid carcinomas. Multiple isoforms have been reported for the MECT1 protein.

Long Name

Transducer of Regulated CREB protein 1

Alternate Names

CRTC1, MECT1, WAMTP1

Gene Symbol

CRTC1

Additional TORC1 Products

Product Documents for TORC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TORC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TORC1 Antibody - BSA Free

Customer Reviews for TORC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TORC1 Antibody - BSA Free and earn rewards!

Have you used TORC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies