Torsin A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85972

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Torsin A. Peptide sequence: AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Torsin A Antibody - BSA Free

Western Blot: Torsin A Antibody [NBP2-85972]

Western Blot: Torsin A Antibody [NBP2-85972]

Western Blot: Torsin A Antibody [NBP2-85972] - WB Suggested Anti-TOR1A Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain
Immunohistochemistry-Paraffin: Torsin A Antibody [NBP2-85972]

Immunohistochemistry-Paraffin: Torsin A Antibody [NBP2-85972]

Immunohistochemistry-Paraffin: Torsin A Antibody [NBP2-85972] - Rabbit Anti-TOR1A Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Plasma membrane. Primary Antibody Concentration: N/A. Other Working Concentrations: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec

Applications for Torsin A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Torsin A

The protein encoded by the Torsin A gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related tothe Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations inthis gene result in the autosomal dominant disorder, torsion dystonia 1. (provided by RefSeq)

Alternate Names

DQ2Torsin family 1 member A, Dystonia 1 protein, dystonia 1, torsion (autosomal dominant; torsin A), DYT1torsin-1A, torsin family 1, member A (torsin A)

Gene Symbol

TOR1A

Additional Torsin A Products

Product Documents for Torsin A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Torsin A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Torsin A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Torsin A Antibody - BSA Free and earn rewards!

Have you used Torsin A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...