TOX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86676

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TOX3 Antibody - BSA Free

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Analysis in human gallbladder and lymph node tissues using NBP1-86676 antibody. Corresponding TOX3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Gallbladder shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676]

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Stomach shows moderate nuclear positivity in glandular cells.
Simple Western: TOX3 Antibody [NBP1-86676]

Simple Western: TOX3 Antibody [NBP1-86676]

Simple Western: TOX3 Antibody [NBP1-86676] - Simple Western lane view shows a specific band for TOX3 in 0.2 mg/ml of RT-4 (left) and SHSY5Y (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: TOX3 Antibody [NBP1-86676]

Simple Western: TOX3 Antibody [NBP1-86676]

Simple Western: TOX3 Antibody [NBP1-86676] - Electropherogram image(s) of corresponding Simple Western lane view. TOX3 antibody was used at 5 ug/ml dilution on RT-4 and SHSY5Y lysates(s).
TOX3 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TOX3 Antibody - BSA Free [NBP1-86676]

Chromatin Immunoprecipitation-exo-Seq: TOX3 Antibody - BSA Free [NBP1-86676]

ChIP-Exo-Seq composite graph for Anti-TOX3 (NBP1-86676) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TOX3 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Simple Western

5 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and SHSY5Y, separated by Size, antibody dilution of 5 ug/mL, apparent MW was 95 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOX3

The protein encoded by the TOX3 gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

CAG trinucleotide repeat-containing gene F9 protein, CAGF9trinucleotide repeat containing 9, TNRC9, TOX high mobility group box family member 3, Trinucleotide repeat-containing gene 9 protein

Gene Symbol

TOX3

Additional TOX3 Products

Product Documents for TOX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOX3 Antibody - BSA Free and earn rewards!

Have you used TOX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...