TPD52 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38952

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TPD52 Antibody - BSA Free

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining in human prostate and skeletal muscle tissues using anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody NBP2-38952 (A) shows similar protein distribution across tissues to independent antibody NBP1-85327 (B).
Western Blot: TPD52 Antibody [NBP2-38952]

Western Blot: TPD52 Antibody [NBP2-38952]

Western Blot: TPD52 Antibody [NBP2-38952] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: TPD52 Antibody [NBP2-38952]

Immunocytochemistry/ Immunofluorescence: TPD52 Antibody [NBP2-38952]

Immunocytochemistry/Immunofluorescence: TPD52 Antibody [NBP2-38952] - Staining of human cell line A-431 shows positivity in cytoplasm and the Golgi apparatus.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human kidney.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952]

Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex.

Applications for TPD52 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TPD52

Alternate Names

D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52

Gene Symbol

TPD52

UniProt

Additional TPD52 Products

Product Documents for TPD52 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TPD52 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TPD52 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TPD52 Antibody - BSA Free and earn rewards!

Have you used TPD52 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...