TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57253

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TR beta 1/NR1A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK

Reactivity Notes

Mouse 82%, Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP2-57253]

Immunocytochemistry/ Immunofluorescence: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP2-57253]

Immunocytochemistry/Immunofluorescence: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP2-57253] - Staining of human cell line SiHa shows localization to nuclear bodies.

Applications for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TR beta 1/NR1A2

Thyroid Hormone Receptor beta is encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Defects in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH).

Long Name

Thyroid Hormone Receptor beta 1

Alternate Names

NR1A2, THRB, v-ErbA2

Gene Symbol

THRB

Additional TR beta 1/NR1A2 Products

Product Documents for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free and earn rewards!

Have you used TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies