TR2/NR2C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56277

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TR2/NR2C1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277] - Staining in human testis and liver tissues using anti-NR2C1 antibody. Corresponding NR2C1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277]

Immunohistochemistry-Paraffin: TR2/NR2C1 Antibody [NBP2-56277] - Staining of human testis shows high expression.
TR2/NR2C1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TR2/NR2C1 Antibody - BSA Free [NBP2-56277]

Chromatin Immunoprecipitation-exo-Seq: TR2/NR2C1 Antibody - BSA Free [NBP2-56277]

ChIP-Exo-Seq composite graph for Anti-NR2C1 (NBP2-56277) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TR2/NR2C1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TR2/NR2C1

NR2C1 encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Long Name

Testicular Orphan Nuclear Receptor 2

Alternate Names

NR2C1

Gene Symbol

NR2C1

Additional TR2/NR2C1 Products

Product Documents for TR2/NR2C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TR2/NR2C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TR2/NR2C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TR2/NR2C1 Antibody - BSA Free and earn rewards!

Have you used TR2/NR2C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...