TRAIL/TNFSF10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38744

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRAIL/TNFSF10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRAIL/TNFSF10 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunocytochemistry/ Immunofluorescence: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunocytochemistry/Immunofluorescence: TRAIL/TNFSF10 Antibody [NBP2-38744] - Immunofluorescent staining of human cell line RT4 shows localization to microtubules & cytokinetic bridge. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Prostate shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human lung shows moderate membranous and cytoplasmic positivity in macrophages and pneumocytes.
Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744]

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Skeletal muscle shows very weak membranous positivity in myocytes.

Applications for TRAIL/TNFSF10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAIL/TNFSF10

Apoptosis or programmed cell death is induced in cells by a group of death domain containing receptors. Binding of ligand to these receptors sends signals that activate members of the caspase family of proteases. The signals ultimately cause degradation of chromosomal DNA by activating DNase. TRAIL (TNF related apoptosis induced ligand) or Apo 2L initiates apoptosis of tumor cells by binding to either of its receptors, DR4 or DR5. These receptors consist of an extracellular TRAIL binding domain and a cytoplasmic "death domain". In addition, two decoy receptors for TRAIL have also been identified. These receptors, designated DcR1 and DcR2, lack the death domain. Binding of TRAIL to either of these receptors, therefore, does not transmit the death signal. Thus, these receptors represent a novel way of regulating cell sensitivity to a pro-apoptotic cytokine at the cell surface. TRAIL is expressed predominantly in spleen, lung, and prostate but also in many other tissues.

Long Name

TNF-related Apoptosis-inducing Ligand

Alternate Names

CD253, TNFSF10

Gene Symbol

TNFSF10

UniProt

P50591

Additional TRAIL/TNFSF10 Products

Product Documents for TRAIL/TNFSF10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRAIL/TNFSF10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAIL/TNFSF10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAIL/TNFSF10 Antibody - BSA Free and earn rewards!

Have you used TRAIL/TNFSF10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies