Translin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35882

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Translin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Translin (NP_004613.1).

Sequence:
GFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Translin Antibody - BSA Free

Translin Antibody

Immunohistochemistry: Translin Antibody [NBP3-35882] -

Immunohistochemistry: Translin Antibody [NBP3-35882] - Immunohistochemistry analysis of paraffin-embedded Mouse spinal cord using Translin Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Translin Antibody

Immunohistochemistry: Translin Antibody [NBP3-35882] -

Immunohistochemistry: Translin Antibody [NBP3-35882] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using Translin Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Translin Antibody

Western Blot: Translin Antibody [NBP3-35882] -

Western Blot: Translin Antibody [NBP3-35882] - Western blot analysis of various lysates using Translin Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Translin Antibody

Immunohistochemistry: Translin Antibody [NBP3-35882] -

Immunohistochemistry: Translin Antibody [NBP3-35882] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Translin Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for Translin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Translin

Translin, also designated testis brain RNA-binding protein (TB-RBP), is a single-stranded DNA- and RNA-binding protein that binds to the 3' UTR regions (Y and H elements) of stored mRNAs, which suppresses their in vitro translation. The human translin gene maps to chromosome 2q21.1 and encodes a 26 kDa protein that has been highly conserved throughout evolution. Translin forms a ring-shaped structure, which is responsible for DNA binding, and also contains a leucine zipper motif, which is thought to enable translin to form dimers. Translin exports specific mRNAs out of the nucleus, supported by its localization in both the nuclei and cytoplasm of neurons, and regulates their translation. Association with Trax (translin-associated factor X), inhibits the binding of translin to RNA, but enhances its binding to single stranded DNA sequences. Breakpoints in the TLS/FUS and CHOP loci contain consensus recognition motifs of translin, which associates with chromosomal translocations in liposarcomas.

Alternate Names

BCLF-1, RCHF1, recombination hotspot associated factor, recombination hotspot-binding protein, REHF-1, TBRBP, translin, TRSLN

Gene Symbol

TSN

Additional Translin Products

Product Documents for Translin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Translin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Translin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Translin Antibody - BSA Free and earn rewards!

Have you used Translin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies