TRAP alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86912

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat, C. elegans

Cited:

Human, Mouse, Nematode - Caenorhabditis elegans

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRAP alpha Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

Reactivity Notes

C. elegans reactivity reported in scientific literature (PMID: 31840061).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRAP alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRAP alpha Antibody [NBP1-86912]

Immunocytochemistry/ Immunofluorescence: TRAP alpha Antibody [NBP1-86912]

Immunocytochemistry/Immunofluorescence: TRAP alpha Antibody [NBP1-86912] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
TRAP alpha Antibody - BSA Free Immunohistochemistry-Paraffin: TRAP alpha Antibody - BSA Free [NBP1-86912]

Immunohistochemistry-Paraffin: TRAP alpha Antibody - BSA Free [NBP1-86912]

Staining of human cerebral cortex, liver).
TRAP alpha Antibody

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
TRAP alpha Antibody

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
TRAP alpha Antibody

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
TRAP alpha Antibody

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: TRAP alpha Antibody [NBP1-86912]

Western Blot: TRAP alpha Antibody [NBP1-86912]

Western Blot: TRAP alpha Antibody [NBP1-86912] - Analysis using Anti-SSR1 antibody NBP1-86912 (A) shows similar pattern to independent antibody NBP1-87815 (B).
TRAP alpha Antibody - BSA Free Western Blot: TRAP alpha Antibody - BSA Free [NBP1-86912]

Western Blot: TRAP alpha Antibody - BSA Free [NBP1-86912]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for TRAP alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAP alpha

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical.

Alternate Names

DKFZp781N23103, FLJ14232, FLJ22100, FLJ23034, FLJ78242, FLJ93042, signal sequence receptor, alpha, SSR alpha subunit, SSR-alpha, translocon-associated protein alpha subunit, translocon-associated protein subunit alpha, TRAP alpha, TRAP-alpha, TRAPASignal sequence receptor subunit alpha

Gene Symbol

SSR1

Additional TRAP alpha Products

Product Documents for TRAP alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRAP alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRAP alpha Antibody - BSA Free

Customer Reviews for TRAP alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAP alpha Antibody - BSA Free and earn rewards!

Have you used TRAP alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies