TRAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47597

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Rat

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRAP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-TRAP1 antibody NBP2-47597 (A) shows similar protein distribution across tissues to independent antibody NBP2-47598 (B).
Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody [NBP2-47597]

Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody [NBP2-47597]

Immunocytochemistry/Immunofluorescence: TRAP1 Antibody [NBP2-47597] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human kidney shows strong to very strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum shows moderate to strong granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in seminiferous ducts.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597]

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human fallopian tube shows strong to very strong granular cytoplasmic positivity in glandular cells.
TRAP1 Antibody

Western Blot: TRAP1 Antibody [NBP2-47597] -

Western Blot: TRAP1 Antibody [NBP2-47597] - Analysis in human cell line CACO-2.
TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 increased MIC60 protein levels of H9C2 cells via alleviating MIC60 ubiquitin-dependent degradation in extracellular acidosis.A, B RT-qPCR and western blot were used to determine the transfection efficiency of TRAP1 in H9C2 cells. C Western blot was used to detect TRAP1 or MIC60 protein levels of H9C2 cells. D, E Western blot was used to detect the degradation of MIC60 protein. F Western blot was used to detect whole cell lysate ubiquitination. G Western blot was used to detect MIC60 protein ubiquitination. CHX (cycloheximide, 20 uM) was used to inhibit protein synthesis. MG132 (10 uM) was used to inhibit proteasome. CQ (Chloroquine phosphate, 10 uM) was used to inhibit lysosomes. Data were the means +/- SD from three independent experiments. Group comparisons were performed by one-way analysis of variance followed by Tukey’s post hoc test. &&P < 0.01 vs. pH 7.4 group. ##P < 0.01 vs. ov-Con group. *P < 0.05 vs. 0 h, CQ or Con group. **P < 0.01 vs. sh-Con or 0 h group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using confocal microscopy in rat’s heart tissue. B Immunoblotting analysis of TRAP1 and MIC60 expression in a co-IP assay performed in protein lysate of rat’s heart tissue with anti-TRAP1 or anti-MIC60 Magnetic beads, respectively. C–D Western blot was used to determine the transfection efficiency of TRAP1 (C) and MIC60 (D) in rats’ heart tissue. E Western blotting was used to detect MIC60 protein levels regulated by TRAP1. F Western blot was used to detect MIC60 protein ubiquitination. Data were the means +/- SD from three independent experiments. Group comparisons were performed by one-way analysis of variance followed by Tukey’s post hoc test. &P < 0.05 vs. Normal group. #P < 0.05 vs. ov-Con group. ##P < 0.01 vs. ov-Con group. *P < 0.05 vs. sh-Con group. **P < 0.01 vs. sh-Con group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using confocal microscopy in rat’s heart tissue. B Immunoblotting analysis of TRAP1 and MIC60 expression in a co-IP assay performed in protein lysate of rat’s heart tissue with anti-TRAP1 or anti-MIC60 Magnetic beads, respectively. C–D Western blot was used to determine the transfection efficiency of TRAP1 (C) and MIC60 (D) in rats’ heart tissue. E Western blotting was used to detect MIC60 protein levels regulated by TRAP1. F Western blot was used to detect MIC60 protein ubiquitination. Data were the means +/- SD from three independent experiments. Group comparisons were performed by one-way analysis of variance followed by Tukey’s post hoc test. &P < 0.05 vs. Normal group. #P < 0.05 vs. ov-Con group. ##P < 0.01 vs. ov-Con group. *P < 0.05 vs. sh-Con group. **P < 0.01 vs. sh-Con group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using confocal microscopy in rat’s heart tissue. B Immunoblotting analysis of TRAP1 and MIC60 expression in a co-IP assay performed in protein lysate of rat’s heart tissue with anti-TRAP1 or anti-MIC60 Magnetic beads, respectively. C–D Western blot was used to determine the transfection efficiency of TRAP1 (C) and MIC60 (D) in rats’ heart tissue. E Western blotting was used to detect MIC60 protein levels regulated by TRAP1. F Western blot was used to detect MIC60 protein ubiquitination. Data were the means +/- SD from three independent experiments. Group comparisons were performed by one-way analysis of variance followed by Tukey’s post hoc test. &P < 0.05 vs. Normal group. #P < 0.05 vs. ov-Con group. ##P < 0.01 vs. ov-Con group. *P < 0.05 vs. sh-Con group. **P < 0.01 vs. sh-Con group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRAP1 Antibody - BSA Free

Western Blot: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 protected mitochondrial cristae and function by increasing MIC60 protein levels in extracellular acidosis.A Western blot was used to determine the transfection efficiency of TRAP1 and MIC60 in H9C2 cells. B Methyl tetramethylrhodamine staining was used to detect mitochondrial membrane potential of H9C2 cells. C CCK8 assay was used to detect the cell viability of H9C2 cells. D ATP assay was used to detect ATP levels of H9C2 cells. E Transmission electron microscopy was used to detect the ultrastructure of mitochondria of H9C2 cells. Twenty-one images were obtained from three independent experiments for each group. The average cristae number in one mitochondrion (n = 30 mitochondria for each group randomly selected from 21 pictures) of each group was quantified. Data were the means +/- SD from three independent experiments. Group comparisons were performed by one-way analysis of variance followed by Tukey’s post hoc test. *P < 0.05 vs. ov-Con/sh-Con group. #P < 0.05 vs. ov-TRAP1/sh-Con group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRAP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody - BSA Free [NBP2-47597] -

TRAP1 directly interacted with MIC60 in H9C2 cells.A Silver staining of TRAP1 immunoprecipitates. B LC-MS/MS of TRAP1 immunoprecipitates. C Representative fragmentation spectrum of the identified MIC60 peptides. D Immunoblotting analysis of TRAP1 and MIC60 expression in a co-IP assay performed in H9C2 cells with anti-TRAP1 or anti-MIC60 Magnetic beads, respectively. E Detection of the colocalization of MIC60 (green) and TRAP1 (red) using confocal microscopy in H9C2 cells. Nuclei were stained using DAPI (blue), (Scale bars, 25 um). Data were the means +/- SD from three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34907169), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TRAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAP1

The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.

Alternate Names

HSP 75, HSP75TNFR-associated protein 1, HSP90Lheat shock protein 75 kDa, mitochondrial, TNF receptor-associated protein 1, TRAP-1, tumor necrosis factor type 1 receptor associated protein, Tumor necrosis factor type 1 receptor-associated protein

Gene Symbol

TRAP1

Additional TRAP1 Products

Product Documents for TRAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRAP1 Antibody - BSA Free

Customer Reviews for TRAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAP1 Antibody - BSA Free and earn rewards!

Have you used TRAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...