TRIB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55386

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TRIB1(tribbles homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of TRIB1 (NP_079471). Peptide sequence TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIB1 Antibody - BSA Free

Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Intestine

Immunohistochemistry-Paraffin: TRIB1 Antibody [NBP1-55386] -

Immunohistochemistry-Paraffin: TRIB1 Antibody [NBP1-55386] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I & II cells; Primary Antibody Concentration: 1:100
Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386] - COLO205, Antibody Dilution: 1.0 ug/ml TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.
Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386]

Western Blot: TRIB1 Antibody [NBP1-55386] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
TRIB1 Antibody - BSA Free

Immunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -

Trib1 expression was downregulated during the early phase of liver regeneration.A–C C57B6/L mice were subjected to partial hepatectomy (2/3 PHx) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. D–F C57B6/L mice were injected with acetaminophen (APAP, 300 mg/kg) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. G, H Primary murine hepatocytes were treated with HGF and harvested at indicated time points. Trib1 expression was examined by qPCR and western blotting. N = 3 biological replicates. Data are expressed as mean +/- S.D. *p < 0.05, one-way ANOVA with post-hoc Scheff´e. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRIB1 Antibody - BSA Free

Immunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -

Trib1 expression was downregulated during the early phase of liver regeneration.A–C C57B6/L mice were subjected to partial hepatectomy (2/3 PHx) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. D–F C57B6/L mice were injected with acetaminophen (APAP, 300 mg/kg) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. G, H Primary murine hepatocytes were treated with HGF and harvested at indicated time points. Trib1 expression was examined by qPCR and western blotting. N = 3 biological replicates. Data are expressed as mean +/- S.D. *p < 0.05, one-way ANOVA with post-hoc Scheff´e. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRIB1 Antibody - BSA Free

Immunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -

Correlation between TRIB1 expression, NRF2 nuclear localization, and hepatocyte proliferation in human ALF specimens.A Human liver biopsy specimens were stained with anti-TRIB1, anti-NRF2, and anti-PCNA. B Linear regression was performed with Graphpad. N = 9. C A schematic model. In quiescent hepatocytes, LXR alpha binds to the Trib1 promoter and activates Trib1 transcription. Trib1 interacts with Nrf2 to sequester Nrf2 in the cytoplasm thus turning off the transcription of antioxidant genes. In proliferating hepatocytes during live regeneration, deactivation of LXR alpha shuts down Trib1 transcription, which unleashes Nrf2 from sequestration. Nrf2 translocates to the nucleus and activates the transcription of antioxidant genes to modulate intracellular redox status fueling cell proliferation. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TRIB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIB1

TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Alternate Names

C8FWG-protein-coupled receptor induced protein, GIG-2, GIG2G-protein-coupled receptor-induced protein 2, G-protein-coupled receptor-induced gene 2 protein, SKIP1, TRB-1, TRB1phosphoprotein regulated by mitogenic pathways, tribbles homolog 1, tribbles homolog 1 (Drosophila), tribbles-like protein 1

Entrez Gene IDs

10221 (Human)

Gene Symbol

TRIB1

UniProt

Additional TRIB1 Products

Product Documents for TRIB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRIB1 Antibody - BSA Free

Customer Reviews for TRIB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIB1 Antibody - BSA Free and earn rewards!

Have you used TRIB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...