TRIM72 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49157

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM72 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPE

Reactivity Notes

Mouse (84%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRIM72 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157] - Staining of human skin shows low expression as expected.
Immunohistochemistry: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry: TRIM72 Antibody [NBP2-49157] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157]

Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157] - Staining in human skeletal muscle and skin tissues using anti-TRIM72 antibody. Corresponding TRIM72 RNA-seq data are presented for the same tissues.

Applications for TRIM72 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM72

Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)

Alternate Names

MG53Mg53, Mitsugumin-53, tripartite motif containing 72, tripartite motif-containing 72, tripartite motif-containing protein 72

Gene Symbol

TRIM72

Additional TRIM72 Products

Product Documents for TRIM72 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM72 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM72 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM72 Antibody - BSA Free and earn rewards!

Have you used TRIM72 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies