TRIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98293

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is EIF3I - C-terminal region. Peptide sequence NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIP1 Antibody - BSA Free

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293] - Sample Type: Human 293T Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1.0 ug/ml Peptide Concentration: 2.0 ug/ml Lysate Quantity: 25 ug/lane
Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293] - HepG2 Cell Lysate 1.0ug/ml, Gel Concentration: 12%
Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293] - Rat brain extract (80ug), concentration 2ug/ml.
Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293] - Human 293T Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1.0 ug/ml Peptide Concentration: 2.0 ug/ml lysate Quantity: 25 ug/ Lane.
Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293]

Western Blot: TRIP1 Antibody [NBP1-98293] - Human 293T, Antibody Dilution: 1.0 ug/ml.

Applications for TRIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIP1

EIF3I is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.

Alternate Names

eIF-3-beta, eIF3-beta, eIF3i, eIF3-p36, EIF3S2TGF-beta receptor-interacting protein 1, Eukaryotic translation initiation factor 3 subunit 2, eukaryotic translation initiation factor 3 subunit I, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa, eukaryotic translation initiation factor 3, subunit I, predicted protein of HQ2242, TGFbeta receptor-interacting protein 1, TRIP-1, TRIP-1eIF3 p36, TRIP1PRO2242

Gene Symbol

EIF3I

UniProt

NP_003748 (Human)

Additional TRIP1 Products

Product Documents for TRIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIP1 Antibody - BSA Free and earn rewards!

Have you used TRIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies