![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0009.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Reactivity Notes
Mouse (81%), Rat (81%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TROP-2 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49166-img0004.jpg "Immunocytochemistry/ Immunofluorescence: TROP-2 Antibody [NBP2-49166]")
Immunocytochemistry/ Immunofluorescence: TROP-2 Antibody [NBP2-49166]
Immunocytochemistry/Immunofluorescence: TROP-2 Antibody [NBP2-49166] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & plasma membrane.![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0013.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]")
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0010.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]")
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0011.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]")
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human liver shows no positivity in hepatocytes, as expected.![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]](https://resources.rndsystems.com/images/products/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0012.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]")
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]
Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human prostate shows strong membranous positivity in glandular cells.
Flow Cytometry: Rabbit Polyclonal TROP-2 Antibody [NBP2-49166] -
Flow Cytometry: Rabbit Polyclonal TROP-2 Antibody [NBP2-49166] - Detection of TROP-2 on CHOK1 cells expressing human TROP-2. Cells received 5 uL of the human TROP-2 antibody (BLUE) or isotype control (RED) for 30 minutes followed by secondary donkey a-rabbit APC antibody. Image from a verified customer review.Applications for TROP-2 Antibody - BSA Free
Application
Recommended Usage
Flow Cytometry
Validated for Flow Cytometry from a verified customer review.
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP2-49166 in the following applications:
Flow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TROP-2
Long Name
Tumor-associated Calcium Signal Transducer 2
Alternate Names
GA733-1, gp50, T16, TACSTD2, TROP2
Gene Symbol
TACSTD2
Additional TROP-2 Products
Product Documents for TROP-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TROP-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for TROP-2 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used TROP-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Flow CytometrySample Tested: CHO cells expressing human Trop2, CHOK1 expressing human TROP2 and CHOK1 expressing hTrop2Species: HumanVerified Customer | Posted 02/15/2024Detection of TROP2 on CHOK1 cells expressing human TROP-2. Cells received 5 μl of the human TROP-2 antibody (BLUE) or isotype control (RED) for 30 minutes followed by secondary donkey a-rabbit APC antibody
Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Liperfluo
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...