TRP2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86892
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human, Canine, Equine
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Canine and equine reactivities reported from verified customer reviews.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TRP2 Antibody - BSA Free
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in equine skin. Tissue sections were incubated with primary antibody for 30 minutes at room temperature. IHC-P image submitted by a verified customer review.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892]
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in canine skin. IHC-P image submitted by a verified customer review.Western Blot: TRP2 Antibody - BSA Free [NBP1-86892]
Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.Applications for TRP2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 2 reviews rated 5 using NBP1-86892 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TRP2
Alternate Names
dopachrome delta-isomerase, dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2), DT, EC 5.3.3.12, L-dopachrome tautomerase, TRP2, TRP-2, Tyrosinase-related protein 2, TYRP2, TYRP2L-dopachrome Delta-isomerase
Gene Symbol
DCT
Additional TRP2 Products
Product Documents for TRP2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TRP2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TRP2 Antibody - BSA Free
Customer Reviews for TRP2 Antibody - BSA Free (2)
5 out of 5
2 Customer Ratings
Have you used TRP2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: skinSpecies: EquineVerified Customer | Posted 10/29/2021TRP2 immunoreactivity in horse skin. Tissue sections were incubated with primary for 30min at room temperature.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
-
Application: Immunohistochemistry-ParaffinSample Tested: skinSpecies: CanineVerified Customer | Posted 10/29/2021TRP2 immunoreactivity in dog skin.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...