TSFM Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93796

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167.1). PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSFM Antibody - Azide and BSA Free

Western Blot: TSFM AntibodyAzide and BSA Free [NBP2-93796]

Western Blot: TSFM AntibodyAzide and BSA Free [NBP2-93796]

Western Blot: TSFM Antibody [NBP2-93796] - Analysis of extracts of various cell lines, using TSFM at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: TSFM Antibody - Azide and BSA Free [NBP2-93796]

Immunocytochemistry/ Immunofluorescence: TSFM Antibody - Azide and BSA Free [NBP2-93796]

Immunocytochemistry/Immunofluorescence: TSFM Antibody [NBP2-93796] - Analysis of U-2 OS cells using TSFM. Blue: DAPI for nuclear staining.

Applications for TSFM Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TSFM

Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]).[supplied by OMIM]

Alternate Names

COXPD3, EFTS, EF-Ts, EFTSMT, EF-TsMt, mitochondrial, mitochondrial elongation factor Ts, Ts translation elongation factor, mitochondrial

Gene Symbol

TSFM

Additional TSFM Products

Product Documents for TSFM Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSFM Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TSFM Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TSFM Antibody - Azide and BSA Free and earn rewards!

Have you used TSFM Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...