TUSC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79375

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TUSC4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human TUSC4The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TUSC4 Antibody - BSA Free

Western Blot: TUSC4 Antibody [NBP1-79375]

Western Blot: TUSC4 Antibody [NBP1-79375]

Western Blot: TUSC4 Antibody [NBP1-79375] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-79375] -

Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-79375] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distribution

Applications for TUSC4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TUSC4

Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs

Alternate Names

G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4

Gene Symbol

NPRL2

UniProt

NP_006536 (Human)

Additional TUSC4 Products

Product Documents for TUSC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TUSC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TUSC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TUSC4 Antibody - BSA Free and earn rewards!

Have you used TUSC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies