TWF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47591

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TWF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TWF2 Antibody - BSA Free

Western Blot: TWF2 Antibody [NBP2-47591]

Western Blot: TWF2 Antibody [NBP2-47591]

Western Blot: TWF2 Antibody [NBP2-47591] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunohistochemistry-Paraffin: TWF2 Antibody [NBP2-47591]

Immunohistochemistry-Paraffin: TWF2 Antibody [NBP2-47591]

Immunohistochemistry-Paraffin: TWF2 Antibody [NBP2-47591] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

Applications for TWF2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TWF2

TWF2, also known as Twinfilin-2, is a 349 amino acid protein that is 40 kDa, ubiquitously expressed at protein level, involved in motile and morphological processes, inhibits actin polymerization by sequestering G-actin, and regulates motility by capping the barbed ends. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles and participates in regulating the mature length of the middle and short rows of stereocilia. Current research is being performed on several diseases and disorders including monkeypox, cowpox, smallpox, vaccinia, meningioma, leukemia, and neuronitis. The TWF2 protein has shown an interaction with ARHGDIA, ACTR3B, CHGB, CAPZA1, and CAPZA2 in positive regulation of lamellipodium assembly, positive regulation of neuron projection development, cell projection organization, negative regulation of actin filament polymerization, and regulation of microvillus length pathways.

Alternate Names

A6-related protein, A6RPFLJ56277, hA6RP, Protein tyrosine kinase 9-like, protein tyrosine kinase 9-like (A6-related protein), PTK9L protein tyrosine kinase 9-like (A6-related protein), PTK9LA6r, twinfilin, actin-binding protein, homolog 2 (Drosophila), Twinfilin-1-like protein, twinfilin-2

Gene Symbol

TWF2

Additional TWF2 Products

Product Documents for TWF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TWF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TWF2 Antibody - BSA Free

Customer Reviews for TWF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TWF2 Antibody - BSA Free and earn rewards!

Have you used TWF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies