TXNDC12 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93457

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all TXNDC12 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1). NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TXNDC12 Antibody - Azide and BSA Free

Western Blot: TXNDC12 AntibodyAzide and BSA Free [NBP2-93457]

Western Blot: TXNDC12 AntibodyAzide and BSA Free [NBP2-93457]

Western Blot: TXNDC12 Antibody [NBP2-93457] - Analysis of extracts of various cell lines, using TXNDC12 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457]

Immunohistochemistry-Paraffin: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457]

Immunohistochemistry-Paraffin: TXNDC12 Antibody [NBP2-93457] - Human liver cancer using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457]

Immunohistochemistry-Paraffin: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457]

Immunohistochemistry-Paraffin: TXNDC12 Antibody [NBP2-93457] - Rat brain using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens).
TXNDC12 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457] -

Immunocytochemistry/ Immunofluorescence: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457] - Immunofluorescence analysis of U-2 OS cells using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TXNDC12 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457] -

Immunocytochemistry/ Immunofluorescence: TXNDC12 Antibody - Azide and BSA Free [NBP2-93457] - Immunofluorescence analysis of NIH-3T3 cells using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for TXNDC12 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TXNDC12

TXNDC12 belongs to the thioredoxin superfamily (see TXN; MIM 187700). Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors (Liu et al., 2003 (PubMed 14557066)).(supplied by OMIM)

Alternate Names

AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)

Gene Symbol

TXNDC12

Additional TXNDC12 Products

Product Documents for TXNDC12 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TXNDC12 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TXNDC12 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TXNDC12 Antibody - Azide and BSA Free and earn rewards!

Have you used TXNDC12 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies