UAP56 Antibody (4A0Q2)

Novus Biologicals | Catalog # NBP3-16873

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4A0Q2 expressed in HEK293
View all UAP56 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 310-428 of human UAP56 (Q13838). QNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UAP56 Antibody (4A0Q2)

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873]

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873]

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873] - Western blot analysis of extracts of various cell lines, using UAP56 Rabbit mAb (NBP3-16873) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873]

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873]

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873] - Western blot analysis of extracts of Rat lung, using UAP56 Rabbit mAb (NBP3-16873) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse brain tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse lung tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse liver tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded human colon tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded rat spleen tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UAP56 Antibody (4A0Q2)

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] -

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded human lung tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for UAP56 Antibody (4A0Q2)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UAP56

UAP56 encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described.

Alternate Names

56 kDa U2AF65-associated protein, ATP-dependent RNA helicase p47, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B, DEAD box protein UAP56, EC 3.6.4.13, HLA-B associated transcript 1, HLA-B-associated transcript 1 protein, spliceosome RNA helicase BAT1, UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)

Gene Symbol

DDX39B

Additional UAP56 Products

Product Documents for UAP56 Antibody (4A0Q2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UAP56 Antibody (4A0Q2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UAP56 Antibody (4A0Q2)

There are currently no reviews for this product. Be the first to review UAP56 Antibody (4A0Q2) and earn rewards!

Have you used UAP56 Antibody (4A0Q2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies