UBTF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82545

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UBTF Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UBTF Antibody - BSA Free

Western Blot: UBTF Antibody [NBP1-82545]

Western Blot: UBTF Antibody [NBP1-82545]

Western Blot: UBTF Antibody [NBP1-82545] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: UBTF Antibody [NBP1-82545]

Immunocytochemistry/ Immunofluorescence: UBTF Antibody [NBP1-82545]

Immunocytochemistry/Immunofluorescence: UBTF Antibody [NBP1-82545] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong positivity in neurons in the CA1 and granular cell layers in the hippocampus.
Western Blot: UBTF Antibody [NBP1-82545]

Western Blot: UBTF Antibody [NBP1-82545]

Western Blot: UBTF Antibody [NBP1-82545] - Analysis in mouse cerebral cortex tissue.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545]

Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse basal forebrain shows moderate nuclear positivity in neurons in the caudate putamen.
Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545]

Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong nuclear positivity in neurons in the cerebral cortex.
UBTF Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UBTF Antibody - BSA Free [NBP1-82545] -

Dual color immunolocalization of tau epitopes in SH-SY5Y cells. (A–C) Replicative SH-SY5Y cells with the visualization of Tau-1, Tau-5, and AT8 epitopes, respectively. (D–F) Differentiated SH-SY5Y cells with the visualization of Tau-1, Tau-5, and AT8 epitopes, respectively. Tau-1, Tau-5, and AT8 were revealed by FITC-conjugated antibodies (green signals). Ki-67 (replication marker) and UBTF (nucleolar marker) were detected by TRITC-conjugated antibodies (red signals). DAPI (blue signals) was used to stain cell nuclei. White arrow in (E) indicates a cell nucleus with the presence of the Ki-67 marker. White arrow in (F) indicates the co-localization of AT8 and UBTF in a nucleus. Magnification is the same for all the images, with a unique scale bar shown in (F): 10 μm. The images were captured by confocal laser scanning microscope at 630× magnification. Software to analyze signal co-localization was ZEN-2010 (see Section 4). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37762676), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for UBTF Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 3 using NBP1-82545 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBTF

Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM]

Alternate Names

90-KDa Nucleolus Organizer Region Autoantigen, Autoantigen NOR-90, NOR-90, nucleolar transcription factor 1, UBF, UBF1, UBF-1, UBF2, UBFUBF-1, upstream binding transcription factor, RNA polymerase I, Upstream-binding factor 1

Gene Symbol

UBTF

Additional UBTF Products

Product Documents for UBTF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBTF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UBTF Antibody - BSA Free

Customer Reviews for UBTF Antibody - BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used UBTF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Ashwini Katre
    Application: Western Blot
    Sample Tested: Human ovarian carcinoma cell lines
    Species: Human
    Verified Customer | Posted 07/24/2014
    UBTF in ovarian cancer cell lines
    UBTF Antibody - BSA Free NBP1-82545

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies