UBXD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58719

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UBXD5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLYPNGVPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIRDTLQNCCPLPARIQEIVVET

Reactivity Notes

Mouse 84%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UBXD5 Antibody - BSA Free

Western Blot: UBXD5 Antibody [NBP2-58719]

Western Blot: UBXD5 Antibody [NBP2-58719]

Western Blot: UBXD5 Antibody [NBP2-58719] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: UBXD5 Antibody [NBP2-58719]

Immunocytochemistry/ Immunofluorescence: UBXD5 Antibody [NBP2-58719]

Immunocytochemistry/Immunofluorescence: UBXD5 Antibody [NBP2-58719] - Staining of human cell line A-431 shows localization to nucleoli.

Applications for UBXD5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBXD5

The UBXD5 gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrim

Alternate Names

COA-1, Colorectal tumor-associated antigen COA-1, colorectal tumor-associated antigen-1, SOCDKFZp686F04228, SOCI, socius, UBX domain containing 5, UBX domain protein 11, UBX domain-containing protein 11, UBX domain-containing protein 5, UBXD5

Gene Symbol

UBXN11

Additional UBXD5 Products

Product Documents for UBXD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBXD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBXD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBXD5 Antibody - BSA Free and earn rewards!

Have you used UBXD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies