UGT2B15 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94747

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2). ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UGT2B15 Antibody - Azide and BSA Free

Western Blot: UGT2B15 AntibodyAzide and BSA Free [NBP2-94747]

Western Blot: UGT2B15 AntibodyAzide and BSA Free [NBP2-94747]

Western Blot: UGT2B15 Antibody [NBP2-94747] - Analysis of extracts of various cell lines, using UGT2B15 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody [NBP2-94747] - Rat kidney using UGT2B15 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody [NBP2-94747] - Human oophoroma using UGT2B15 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747]

Immunohistochemistry-Paraffin: UGT2B15 Antibody [NBP2-94747] - Mouse spleen using UGT2B15 antibody at dilution of 1:100 (40x lens).
UGT2B15 Antibody - Azide and BSA Free

Western Blot: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747] -

Expression of UGT2B15 in breast cancer cell lines. (A) Total RNA was obtained from confluent T47D and MCF7 cells and UGT2B15 mRNA levels were measured by RT-QPCR. A value of 1 was assigned to the UGT2B15 mRNA levels in T47D cells. * p < 0.01 vs. T47D cells. (B) Total protein was obtained from confluent T47D and MCF7 cell lines and UGT2B15, IGF1R, INSR, and p53 protein levels were measured by Western blots. Relative protein levels are expressed as protein levels normalized to the corresponding HSP70 value. Results of a representative experiment are shown, repeated three times with similar results. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35626664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UGT2B15 Antibody - Azide and BSA Free

Western Blot: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747] -

Expression of UGT2B15 in endometrial cancer cell lines. (A) Total RNA was obtained from confluent USPC-1 and USPC-2 endometrial cancer cell lines and UGT2B15 mRNA levels were measured by RT-QPCR. A value of 1 was assigned to the UGT2B15 mRNA levels in USPC-1 cells. * p < 0.01 vs. USPC-1 cells. (B) Total protein was obtained from confluent USPC-1 and USPC-2 cell lines and UGT2B15, IGF1R, INSR, and p53 protein levels were measured by Western blots. HSP70 levels were assessed as a loading control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35626664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UGT2B15 Antibody - Azide and BSA Free

Western Blot: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747] -

Effect of UGT2B15 abrogation on IGF1R signaling and cellular proliferation. MCF7 (A,B) and T47D (C,D) were treated with siRNA against UGT2B15 (or NT for control purposes) for 72-h (MCF7) or 96 h (T47D). At the end of the incubation period, cells were harvested, and the levels of IGF1R, INSR, UGT2B15, phospho- and total- AKT and ERK1/2, and p53 were measured by Western blots. HSP70 levels were measured as a loading control. Relative protein levels are expressed as protein levels normalized to the corresponding HSP70 value. Results of a typical experiment are presented. For cell proliferation measurements, cells were treated with siRNA against UGT2B15 (or NT siRNA) for 72 h (MCF7) or 96 h (T47D). Cells were counted using a cell counter. A value of 100% was given to the cell number in NT-treated (control) cells. * p < 0.01 vs. NT-treated cells. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35626664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UGT2B15 Antibody - Azide and BSA Free

Western Blot: UGT2B15 Antibody - Azide and BSA Free [NBP2-94747] -

Effect of IGF1R and INSR inhibition on UGT2B15 gene expression. (A) MCF7 cells were treated with the selective IGF1R inhibitor AEW541 (10 mM) for 48 h (or left untreated, C), after which cells were harvested, total protein was prepared, and IGF1R, UGT2B15, and p53 levels were measured by Western blots. HSP70 levels were measured as a loading control. The bar graph denotes UGT2B15 and IGF1R levels in control (solid bars) and AEW541 treated cells (striped bars). (B) T47D cells were treated with the INSR inhibitor S961 (100 nM and 1 mM) for 2 h. Cells were then harvested and levels of phospho- and total-INSR, UGT2B15, and p53 levels were measured by Western blots. A value of 100% was given to control, untreated cells. * p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35626664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for UGT2B15 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:100-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UGT2B15

The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]

Alternate Names

EC 2.4.1, EC 2.4.1.17, HLUG4, UDP glucuronosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2B15, UDP-glucuronosyltransferase 2B15, UDP-glucuronosyltransferase 2B8, UDP-glucuronosyltransferase UGT2B15, UDP-glucuronyltransferase, family 2, beta-15, UDPGT 2B15, UDPGT 2B8, UDPGTH3, UDPGTh-3, UGT2B8UDPGT2B15

Gene Symbol

UGT2B15

Additional UGT2B15 Products

Product Documents for UGT2B15 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UGT2B15 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for UGT2B15 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review UGT2B15 Antibody - Azide and BSA Free and earn rewards!

Have you used UGT2B15 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...