UQCRC2 Antibody (3E3O8)

Novus Biologicals | Catalog # NBP3-16390

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3E3O8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human UQCRC2 (P22695). KANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UQCRC2 Antibody (3E3O8)

Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Western blot analysis of extracts of various cell lines, using UQCRC2 Rabbit mAb (NBP3-16390) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Immunohistochemistry-Paraffin: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Immunohistochemistry-Paraffin: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry of paraffin-embedded human colon using UQCRC2 Rabbit mAb (NBP3-16390) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390]

Western Blot: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Western blot analysis of extracts of Mouse heart, using UQCRC2 Rabbit mAb (NBP3-16390) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Rat pancreas tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody (3E3O8)

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] -

Immunohistochemistry: UQCRC2 Antibody (3E3O8) [NBP3-16390] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using UQCRC2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for UQCRC2 Antibody (3E3O8)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UQCRC2

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex),which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex

Alternate Names

Complex III subunit 2, Core protein II, cytochrome b-c1 complex subunit 2, mitochondrial, QCR2, ubiquinol-cytochrome c reductase core protein II, Ubiquinol-cytochrome-c reductase complex core protein 2, UQCR2

Gene Symbol

UQCRC2

Additional UQCRC2 Products

Product Documents for UQCRC2 Antibody (3E3O8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UQCRC2 Antibody (3E3O8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UQCRC2 Antibody (3E3O8)

There are currently no reviews for this product. Be the first to review UQCRC2 Antibody (3E3O8) and earn rewards!

Have you used UQCRC2 Antibody (3E3O8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...