USP7 Antibody (3J7G1)

Novus Biologicals | Catalog # NBP3-16188

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3J7G1 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human USP7 (Q93009). MVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for USP7 Antibody (3J7G1)

Western Blot: USP7 Antibody (3J7G1) [NBP3-16188]

Western Blot: USP7 Antibody (3J7G1) [NBP3-16188]

Western Blot: USP7 Antibody (3J7G1) [NBP3-16188] - Western blot analysis of extracts of various cell lines, using USP7 Rabbit mAb (NBP3-16188) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
USP7 Antibody (3J7G1)

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] -

Immunohistochemistry: USP7 Antibody (3J7G1) [NBP3-16188] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using USP7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for USP7 Antibody (3J7G1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: USP7

HAUSP (also known as deubiquitinating enzyme 7, herpes virus associated ubiquitin specific protease, TEF1, ubiquitin carboxyl terminal hydrolase 7, ubiquitin specific protease 7, ubiquitin thiolesterase 7, and USP7) is a novel p53 interacting protein. HAUSP was identified by mass spectrometry of affinity-purified p53 associated factors by Li et al. HAUSP strongly stabilizes p53 even in the presence of excess MDM2, and also induces p53-dependent cell growth repression and apoptosis. HAUSP has an intrinsic enzymatic activity that specifically de-ubiquitinates p53 both in vivo and in vitro. Expression of a catalytically inactive point mutation of HAUSP in cells increased the levels of p53 ubiquitination and also destabilized p53. Li et al concluded that their findings revealed an important mechanism by which p53 can be stabilized by direct de-ubiquitination and also implied that HAUSP may function as a tumor suppressor in vivo through the stabilization of p53.

Long Name

Ubiquitin Specific Protease 7

Alternate Names

HAUSP, TEF1

Gene Symbol

USP7

Additional USP7 Products

Product Documents for USP7 Antibody (3J7G1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for USP7 Antibody (3J7G1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for USP7 Antibody (3J7G1)

There are currently no reviews for this product. Be the first to review USP7 Antibody (3J7G1) and earn rewards!

Have you used USP7 Antibody (3J7G1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...