VAMP3/Cellubrevin Antibody (2H8R8)

Novus Biologicals | Catalog # NBP3-16705

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2H8R8 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VAMP3/Cellubrevin (Q15836). MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP3/Cellubrevin Antibody (2H8R8)

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Analysis of extracts of various cell lines, using VAMP3/VAMP3/Cellubrevin Rabbit mAb (NBP3-16705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Analysis of extracts of Mouse liver, using VAMP3/VAMP3/Cellubrevin Rabbit mAb (NBP3-16705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
VAMP3/Cellubrevin Antibody (2H8R8)

Immunocytochemistry/ Immunofluorescence: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] -

Immunocytochemistry/ Immunofluorescence: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Immunofluorescence analysis of U-2 OS cells using VAMP3/VAMP3/Cellubrevin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for VAMP3/Cellubrevin Antibody (2H8R8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAMP3/Cellubrevin

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP-25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, all VAMP isoform levels appear to be significantly reduced.

Alternate Names

CEBCellubrevin, cellubrevin, SYB3, synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin)

Gene Symbol

VAMP3

Additional VAMP3/Cellubrevin Products

Product Documents for VAMP3/Cellubrevin Antibody (2H8R8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAMP3/Cellubrevin Antibody (2H8R8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAMP3/Cellubrevin Antibody (2H8R8)

There are currently no reviews for this product. Be the first to review VAMP3/Cellubrevin Antibody (2H8R8) and earn rewards!

Have you used VAMP3/Cellubrevin Antibody (2H8R8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...