Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-02994

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Vanilloid R-like 3/TRPV3 (NP_659505.1). DNSVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVLIWAMCISVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Western Blot:Vanilloid R-like 3/TRPV3 Antibody - BSA Free-

Western Blot:Vanilloid R-like 3/TRPV3 Antibody - BSA Free- Analysis of extracts of various cell lines, using TRPV3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Applications for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Vanilloid R-like 3/TRPV3

Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.

Long Name

Vanilloid Receptor Like 3/Transient Receptor Potential Cation Channel 3

Alternate Names

TRPV3, VanilloidR like 3, VanilloidR-like3, VRL3

Gene Symbol

TRPV3

Additional Vanilloid R-like 3/TRPV3 Products

Product Documents for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Vanilloid R-like 3/TRPV3 Antibody - BSA Free and earn rewards!

Have you used Vanilloid R-like 3/TRPV3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...